Πληροφορίες

Γιατί η αλληλουχία αμινοξέων που παρουσιάζονται στον Άτλαντα Καταλυτικής Θέσης από μια δεδομένη πρωτεΐνη διαφέρει από την ακολουθία στην Τράπεζα δεδομένων πρωτεϊνών RSCB

Γιατί η αλληλουχία αμινοξέων που παρουσιάζονται στον Άτλαντα Καταλυτικής Θέσης από μια δεδομένη πρωτεΐνη διαφέρει από την ακολουθία στην Τράπεζα δεδομένων πρωτεϊνών RSCB


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Wantedθελα να συγκρίνω την αλληλουχία αμινοξέων των ενζύμων για αυτό το έργο που δουλεύω και πρέπει να τα συγκρίνω στην καταλυτική τους θέση. Για αυτό, πήγα στον Άτλαντα Καταλυτικής Ιστοσελίδας για να λάβω τις πληροφορίες σχετικά με τον καταλυτικό ιστότοπο, αλλά επειδή δεν μου προσφέρουν έναν εύκολο τρόπο για να κατεβάσω προγραμματικά τα δεδομένα δομής, τα κατέβασα από το PDB RSCB κατεβάζοντας την ακολουθία fasta. Κατά τον έλεγχο των καταλυτικών ιστότοπων δεν ταίριαζε με αυτό που μου έλεγε το CSA και τότε συνειδητοποίησα ότι πρόκειται για διαφορετικά αρχεία. Πάρτε για παράδειγμα το 3nos, το CSA παρουσιάζει την ακόλουθη ακολουθία:

MGNLKS…

Ενώ το ΠΣΠ παρουσιάζει την ακόλουθη σειρά:

PKFPRV…

Γιατί δεν έχουν την ίδια σειρά αν είναι η ίδια πρωτεΐνη;

Συγγνώμη αν είναι μια noob ερώτηση, δεν είμαι βιολόγος, απλώς ένας επιστήμονας υπολογιστών που τυχαίνει να του αρέσει η βιοπληροφορική.

Σημαντικές πληροφορίες:

Τα δεδομένα CSA προέρχονται από εδώ, ενώ τα δεδομένα PDB προέρχονται από εδώ


Τα αποτελέσματα κρυσταλλογραφίας (αρχεία pdb) περιέχουν σχεδόν πάντα μια περικομμένη ακολουθία.

Και τα δύο άκρα μιας πρωτεΐνης είναι συχνά εύκαμπτα (ακόμη και σε κρύσταλλο) και δεν καταλήγουν σε αρκετά δεδομένα για καλή εφαρμογή. Τα αντίστοιχα υπολείμματα αφαιρούνται από το μοντέλο και την ακολουθία και σας μένουν μόνο τα υπολείμματα που δείχνουν μια καθορισμένη πυκνότητα ηλεκτρονίων.


Η μία ακολουθία περιέχεται εν μέρει στην άλλη (επισημασμένη).

Έτσι, η ακολουθία CSA είναι (μορφή FASTA, περικομμένη):

> sp | P29474 | NOS3_HUMAN Συνθάση νιτρικού οξειδίου, ενδοθηλιακό λειτουργικό σύστημα = Homo sapiens GN = NOS3 PE = 1 SV = 3
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP EQLLQQARFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN

λαμβάνονται από http://www.uniprot.org/uniprot/P29474 για διευκόλυνση.

Ενώ το PDB είναι:

> 3NOS: A | PDBID | ΑΛΥΣΙΔΑ | ΑΚΟΛΟΥΘΙΑ PKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQA HEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLR SAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLL ...

Η καταχώριση Uniprot αναφέρει 3 διαφορετικές ισομορφές λόγω εναλλακτικού ματίσματος, οπότε ίσως αυτό είναι που συμβαίνει εδώ. Εδώ είναι η έξοδος από μια ευθυγράμμιση ακολουθίας (χρησιμοποιώντας https://www.ebi.ac.uk/Tools/psa/emboss_matcher/):

#======================================= # # Στοίχιση_ακολουθίες: 2 # 1: NOS3_HUMAN # 2: SEQUENCE # Matrix: EBLOSUM62 # Gap_penalty: 14  # Extend_penalty: 4 # # Μήκος: 240 # Ταυτότητα: 240/240 (100.0%) # Ομοιότητα: 240/240 (100.0%) # Κενά: 0/240 (0.0% ) # Βαθμολογία: 1294 # # #======================================= NOS3_HUMAN 66 PKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPPRKL 115 |||||||||||||||||||||||||||||||| | SEQUENCE 1 PKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSP 50 NOS3_HUMAN 116 GPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQYQ |||||||||| |||||||| SEQUENCE 51 GPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQL 100 NOS3_HUMAN 166 RESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMF||||||||||||||||||| |||||||| ΑΚΟΛΟΥΘΙΑ 101 RESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHI 150 NOS3_HUMAN 216 KYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQ||||||||||||||||||| ||||||||| ΑΚΟΛΟΥΘΙΑ 151 KYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDP 200 NOS3_HUMAN 266 ANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLL 305 |||||||||||||||||||||||| ΑΚΟΛΟΥΘΙΑ 201 ANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLL 240

Αυτή η απάντηση είναι σωστή, απλώς ήθελα να προσθέσω ότι η σωστή αρίθμηση ακολουθίας διατηρείται στο αρχείο PDB στην εγγραφή DBREF (την οποία μπορείτε να δείτε ανοίγοντας το PDB σε έναν επεξεργαστή κειμένου):

DBREF 3NOS A 66 492 UNP P29474 NOS3_HUMAN 66 492

Σε απλά αγγλικά, η ακολουθία που παρουσιάζεται σε αυτό το αρχείο (3NOSαλυσίδαΕΝΑ) αντιστοιχεί σε υπολείμματα66-492του σχετικού UniProt (UNP) είσοδος (προσχώρηση:Ρ29474).


Δες το βίντεο: PDB Tutorial: A Basic How-To (Νοέμβριος 2022).